SCOPe 2.08: Domain d2dena_: 2den A:

Lineage for d2dena_ (2den A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.2: UBA-like [46934] (5 families)

5. Family a.5.2.0: automated matches [254220] (1 protein)
   not a true family

6. Protein automated matches [254501] (2 species)
   not a true protein

7. Species Streptococcus sp. [TaxId:1306] [255096] (2 PDB entries)

8. Domain d2dena_: 2den A: [238633]
   Other proteins in same PDB: d2denb_
   automated match to d2daha1

Details for d2dena_

PDB Entry: 2den

PDB Description: solution structure of the ubiquitin-associated domain of human bmsc- ubp and its complex with ubiquitin

PDB Compounds: (A:) Immunoglobulin G-binding protein G,Ubiquitin-like protein 7

SCOPe Domain Sequences for d2dena_:

Sequence; same for both SEQRES and ATOM records:

>d2dena_ a.5.2.0 (A:) automated matches {Streptococcus sp. [TaxId: 1306]}
gsqwqpqlqqlrdmgiqddelslralqatggdiqaalelifaggap

Timeline for d2dena_:

• d2dena_ first appeared in SCOPe 2.04
  
• d2dena_ appears in SCOPe 2.07