SCOPe 2.04: Domain d2bxka3: 2bxk A:3-196

Lineage for d2bxka3 (2bxk A:3-196)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (2 families)

5. Family a.126.1.0: automated matches [254216] (1 protein)
   not a true family

6. Protein automated matches [254493] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255068] (15 PDB entries)

8. Domain d2bxka3: 2bxk A:3-196 [238629]
   automated match to d3jrya1
   complexed with azq, imn, myr

Details for d2bxka3

PDB Entry: 2bxk, 2.4 Å

PDB Description: human serum albumin complexed with myristate, azapropazone and indomethacin

PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d2bxka3:

Sequence; same for both SEQRES and ATOM records:

>d2bxka3 a.126.1.0 (A:3-196) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hksevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaenc
dkslhtlfgdklctvatlretygemadccakqepernecflqhkddnpnlprlvrpevdv
mctafhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllpkl
delrdegkassakq

Timeline for d2bxka3:

• d2bxka3 is new in SCOPe 2.04-stable
  
• d2bxka3 appears in SCOPe 2.05
  
• d2bxka3 appears in the current release, SCOPe 2.08