Class a: All alpha proteins [46456] (289 folds) |
Fold a.126: Serum albumin-like [48551] (1 superfamily) multihelical; one domain consists of two similar disulfide-linked subdomains |
Superfamily a.126.1: Serum albumin-like [48552] (2 families) |
Family a.126.1.0: automated matches [254216] (1 protein) not a true family |
Protein automated matches [254493] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255068] (15 PDB entries) |
Domain d2bxdb3: 2bxd B:5-196 [238627] automated match to d3jrya1 complexed with rwf |
PDB Entry: 2bxd (more details), 3.05 Å
SCOPe Domain Sequences for d2bxdb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bxdb3 a.126.1.0 (B:5-196) automated matches {Human (Homo sapiens) [TaxId: 9606]} sevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaencdk slhtlfgdklctvatlretygemadccakqepernecflqhkddnpnlprlvrpevdvmc tafhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllpklde lrdegkassakq
Timeline for d2bxdb3: