SCOPe 2.07: Domain d2assa2: 2ass A:1085-1160

Lineage for d2assa2 (2ass A:1085-1160)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
   multihelical; interlocked heterodimer with F-box proteins

4. Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families)
   automatically mapped to Pfam PF01466

5. Family a.157.1.1: Skp1 dimerisation domain-like [81380] (3 proteins)

6. Protein Cyclin A/CDK2-associated p45, Skp1 [81378] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [81376] (9 PDB entries)

8. Domain d2assa2: 2ass A:1085-1160 [238619]
   Other proteins in same PDB: d2assa1, d2assb1, d2assb2, d2assc_
   automated match to d1fqvb1
   complexed with ben, po4

Details for d2assa2

PDB Entry: 2ass, 3 Å

PDB Description: crystal structure of the skp1-skp2-cks1 complex

PDB Compounds: (A:) S-phase kinase-associated protein 1A

SCOPe Domain Sequences for d2assa2:

Sequence; same for both SEQRES and ATOM records:

>d2assa2 a.157.1.1 (A:1085-1160) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]}
ipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfniknd
fteeeeaqvrkenqwc

Timeline for d2assa2:

• d2assa2 first appeared in SCOPe 2.04
  
• d2assa2 appears in SCOPe 2.06
  
• d2assa2 appears in the current release, SCOPe 2.08