| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily) multihelical; interlocked heterodimer with F-box proteins |
Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families) ![]() automatically mapped to Pfam PF01466 |
| Family a.157.1.1: Skp1 dimerisation domain-like [81380] (3 proteins) |
| Protein Cyclin A/CDK2-associated p45, Skp1 [81378] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [81376] (9 PDB entries) |
| Domain d2assa2: 2ass A:1085-1160 [238619] Other proteins in same PDB: d2assa1, d2assb1, d2assb2, d2assc_ automated match to d1fqvb1 complexed with ben, po4 |
PDB Entry: 2ass (more details), 3 Å
SCOPe Domain Sequences for d2assa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2assa2 a.157.1.1 (A:1085-1160) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]}
ipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfniknd
fteeeeaqvrkenqwc
Timeline for d2assa2: