SCOPe 2.04: Domain d1wbdb3: 1wbd B:567-800

Lineage for d1wbdb3 (1wbd B:567-800)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (79 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [226067] (4 PDB entries)

8. Domain d1wbdb3: 1wbd B:567-800 [238595]
   Other proteins in same PDB: d1wbda1, d1wbda3, d1wbda4, d1wbdb1, d1wbdb2
   automated match to d1wb9a2
   protein/DNA complex; complexed with adp, mg; mutant

Details for d1wbdb3

PDB Entry: 1wbd, 2.4 Å

PDB Description: crystal structure of e. coli dna mismatch repair enzyme muts, e38q mutant, in complex with a g.t mismatch

PDB Compounds: (B:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d1wbdb3:

Sequence, based on SEQRES records:

>d1wbdb3 c.37.1.0 (B:567-800) automated matches {Escherichia coli [TaxId: 562]}
ytcptfidkpgiritegrhpvveqvlnepfianplnlspqrrmliitgpnmggkstymrq
talialmayigsyvpaqkveigpidriftrvgaaddlasgrstfmvemtetanilhnate
yslvlmdeigrgtstydglslawacaenlankikaltlfathyfeltqlpekmegvanvh
ldalehgdtiafmhsvqdgaasksyglavaalagvpkevikrarqklrelesis

Sequence, based on observed residues (ATOM records):

>d1wbdb3 c.37.1.0 (B:567-800) automated matches {Escherichia coli [TaxId: 562]}
ytcptfidkpgiritegrhpvveqvlnepfianplnlspqrrmliitgpnmggkstymrq
talialmayigsyvpaqkveigpidriftrvgtfmvemtetanilhnateyslvlmdeig
rgtstydglslawacaenlankikaltlfathyfeltqlpekmegvanvhldalehgdti
afmhsvqdgaasksyglavaalagvpkevikrarqklrelesis

Timeline for d1wbdb3:

• d1wbdb3 is new in SCOPe 2.04-stable
  
• d1wbdb3 appears in SCOPe 2.05
  
• d1wbdb3 appears in the current release, SCOPe 2.08