Lineage for d1aly__ (1aly -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.22: TNF-like [49841] (1 superfamily) Superfamily b.22.1: TNF-like [49842] (1 family) 
Family b.22.1.1: TNF-like [49843] (4 proteins) 
Protein Extracellular domain of CD40 ligand [49844] (1 species) Species Human (Homo sapiens) [TaxId:9606] [49845] (1 PDB entry) 
Domain d1aly__: 1aly - [23856]
Details for d1aly__
PDB Entry: 1aly (more details), 2 Å
PDB Description: crystal structure of human cd40 ligand
SCOP Domain Sequences for d1aly__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aly__ b.22.1.1 (-) Extracellular domain of CD40 ligand {Human (Homo sapiens)}
gdqnpqiaahviseasskttsvlqwaekgyytmsnnlvtlengkqltvkrqglyyiyaqv
tfcsnreassqapfiaslclkspgrferillraanthssakpcgqqsihlggvfelqpga
svfvnvtdpsqvshgtgftsfgllkl
SCOP Domain Coordinates for d1aly__:
Click to download the PDB-style file with coordinates for d1aly__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1aly__:
- d1aly__ appears in SCOP 1.57
- d1aly__ appears in the current release, SCOPe 2.08, called d1alya_
View in 3D