Lineage for d1teec2 (1tee C:247-393)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1881081Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1881082Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1881522Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins)
  6. 1881736Protein Polyketide synthase PKS18 [110758] (1 species)
  7. 1881737Species Mycobacterium tuberculosis [TaxId:1773] [110759] (2 PDB entries)
    Uniprot Q79FQ0
  8. 1881751Domain d1teec2: 1tee C:247-393 [238555]
    mutant

Details for d1teec2

PDB Entry: 1tee (more details), 2.9 Å

PDB Description: crystal structure of c205f mutant of pks18 from mycobacterium tuberculosis
PDB Compounds: (C:) pks18

SCOPe Domain Sequences for d1teec2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1teec2 c.95.1.2 (C:247-393) Polyketide synthase PKS18 {Mycobacterium tuberculosis [TaxId: 1773]}
vvvrssfsqlldntedgivlgvnhngitcelsenlpgyifsgvapvvtemlwdnglqisd
idlwaihpggpkiieqsvrslgisaelaaqswdvlarfgnmlsvslifvletmvqqaesa
kaistgvafafgpgvtvegmlfdiirr

SCOPe Domain Coordinates for d1teec2:

Click to download the PDB-style file with coordinates for d1teec2.
(The format of our PDB-style files is described here.)

Timeline for d1teec2: