SCOPe 2.06: Domain d1teeb2: 1tee B:247-393

Lineage for d1teeb2 (1tee B:247-393)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins)

6. Protein Polyketide synthase PKS18 [110758] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [110759] (2 PDB entries)
   Uniprot Q79FQ0

8. Domain d1teeb2: 1tee B:247-393 [238553]
   mutant

Details for d1teeb2

PDB Entry: 1tee, 2.9 Å

PDB Description: crystal structure of c205f mutant of pks18 from mycobacterium tuberculosis

PDB Compounds: (B:) pks18

SCOPe Domain Sequences for d1teeb2:

Sequence; same for both SEQRES and ATOM records:

>d1teeb2 c.95.1.2 (B:247-393) Polyketide synthase PKS18 {Mycobacterium tuberculosis [TaxId: 1773]}
vvvrssfsqlldntedgivlgvnhngitcelsenlpgyifsgvapvvtemlwdnglqisd
idlwaihpggpkiieqsvrslgisaelaaqswdvlarfgnmlsvslifvletmvqqaesa
kaistgvafafgpgvtvegmlfdiirr

Timeline for d1teeb2:

• d1teeb2 first appeared in SCOPe 2.04
  
• d1teeb2 appears in SCOPe 2.05
  
• d1teeb2 appears in SCOPe 2.07
  
• d1teeb2 appears in the current release, SCOPe 2.08