Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins) |
Protein Polyketide synthase PKS18 [110758] (1 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [110759] (2 PDB entries) Uniprot Q79FQ0 |
Domain d1tedd2: 1ted D:247-393 [238549] complexed with myr |
PDB Entry: 1ted (more details), 2.25 Å
SCOPe Domain Sequences for d1tedd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tedd2 c.95.1.2 (D:247-393) Polyketide synthase PKS18 {Mycobacterium tuberculosis [TaxId: 1773]} vvvrssfsqlldntedgivlgvnhngitcelsenlpgyifsgvapvvtemlwdnglqisd idlwaihpggpkiieqsvrslgisaelaaqswdvlarfgnmlsvslifvletmvqqaesa kaistgvafafgpgvtvegmlfdiirr
Timeline for d1tedd2: