![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins) |
![]() | Protein Polyketide synthase PKS18 [110758] (1 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [110759] (2 PDB entries) Uniprot Q79FQ0 |
![]() | Domain d1teda2: 1ted A:247-393 [238543] complexed with myr |
PDB Entry: 1ted (more details), 2.25 Å
SCOPe Domain Sequences for d1teda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1teda2 c.95.1.2 (A:247-393) Polyketide synthase PKS18 {Mycobacterium tuberculosis [TaxId: 1773]} vvvrssfsqlldntedgivlgvnhngitcelsenlpgyifsgvapvvtemlwdnglqisd idlwaihpggpkiieqsvrslgisaelaaqswdvlarfgnmlsvslifvletmvqqaesa kaistgvafafgpgvtvegmlfdiirr
Timeline for d1teda2: