SCOPe 2.04: Domain d1t6bx2: 1t6b X:16-225

Lineage for d1t6bx2 (1t6b X:16-225)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.179: Anthrax protective antigen N-terminal-like [254104] (1 superfamily)
   core: sandwich; 10-12 strands in 2 sheets; jelly roll; may contain inserted subdomains

4. Superfamily b.179.1: PA14-like [254123] (3 families)

5. Family b.179.1.1: PA14 [254147] (2 proteins)
   Pfam PF07691

6. Protein PA14 [254334] (1 species)

7. Species Bacillus anthracis [254763] (14 PDB entries)

8. Domain d1t6bx2: 1t6b X:16-225 [238541]
   Other proteins in same PDB: d1t6bx1, d1t6by_
   complexed with ca, mn, na, pg4

Details for d1t6bx2

PDB Entry: 1t6b, 2.5 Å

PDB Description: Crystal structure of B. anthracis Protective Antigen complexed with human Anthrax toxin receptor

PDB Compounds: (X:) Protective antigen

SCOPe Domain Sequences for d1t6bx2:

Sequence, based on SEQRES records:

>d1t6bx2 b.179.1.1 (X:16-225) PA14 {Bacillus anthracis}
sqgllgyyfsdlnfqapmvvtssttgdlsipsselenipsenqyfqsaiwsgfikvkksd
eytfatsadnhvtmwvddqevinkasnsnkirlekgrlyqikiqyqrenptekgldfkly
wtdsqnkkevissdnlqlpelkqkssnsrkkrstsagptvpdrdndgipdslevegytvd
vknkrtflspwisnihekkgltkyksspek

Sequence, based on observed residues (ATOM records):

>d1t6bx2 b.179.1.1 (X:16-225) PA14 {Bacillus anthracis}
sqgllgyyfsdlnfqapmvvtssttgdlsipsselenipsenqyfqsaiwsgfikvkksd
eytfatsadnhvtmwvddqevinkasnsnkirlekgrlyqikiqyqrenptekgldfkly
wtdsqnkkevissdnlqlpelkqvpdrdndgipdslevegytvdvknkrtflspwisnih
ekkgltkyksspek

Timeline for d1t6bx2:

• d1t6bx2 is new in SCOPe 2.04-stable
  
• d1t6bx2 appears in SCOPe 2.05
  
• d1t6bx2 appears in the current release, SCOPe 2.08