Lineage for d1sqqe1 (1sqq E:1-69)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1957421Fold f.23: Single transmembrane helix [81407] (40 superfamilies)
    not a true fold
  4. 1958070Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families) (S)
  5. 1958120Family f.23.12.0: automated matches [254198] (1 protein)
    not a true family
  6. 1958121Protein automated matches [254432] (4 species)
    not a true protein
  7. 1958141Species Cow (Bos taurus) [TaxId:9913] [254897] (1 PDB entry)
  8. 1958142Domain d1sqqe1: 1sqq E:1-69 [238538]
    Other proteins in same PDB: d1sqqa1, d1sqqa2, d1sqqb1, d1sqqb2, d1sqqc1, d1sqqc2, d1sqqd1, d1sqqd2, d1sqqe2, d1sqqf1, d1sqqg_, d1sqqh_, d1sqqi_, d1sqqj_, d1sqqk1
    automated match to d1bcce2
    complexed with fes, hem, ost, uq2

Details for d1sqqe1

PDB Entry: 1sqq (more details), 3 Å

PDB Description: Crystal Structure Analysis of Bovine Bc1 with Methoxy Acrylate Stilbene (MOAS)
PDB Compounds: (E:) Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) [Contains: Ubiquinol-cytochrome c reductase 8 kDa protein (Complex III subunit IX)]

SCOPe Domain Sequences for d1sqqe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqqe1 f.23.12.0 (E:1-69) automated matches {Cow (Bos taurus) [TaxId: 9913]}
shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs
smsasadvl

SCOPe Domain Coordinates for d1sqqe1:

Click to download the PDB-style file with coordinates for d1sqqe1.
(The format of our PDB-style files is described here.)

Timeline for d1sqqe1: