SCOPe 2.05: Domain d1sp9a2: 1sp9 A:233-428

Lineage for d1sp9a2 (1sp9 A:233-428)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
   duplication: consists of 2 similar domains with 2 repeats in each
   Similar to the Methylmalonyl-CoA epimerase dimer

6. Protein 4-hydroxyphenylpyruvate dioxygenase, HppD [54608] (6 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [110877] (4 PDB entries)
   Uniprot P93836 33-428 ! Uniprot P93836 63-459

8. Domain d1sp9a2: 1sp9 A:233-428 [238535]
   complexed with fe2

Details for d1sp9a2

PDB Entry: 1sp9, 3 Å

PDB Description: 4-Hydroxyphenylpyruvate Dioxygenase

PDB Compounds: (A:) 4-hydroxyphenylpyruvate dioxygenase

SCOPe Domain Sequences for d1sp9a2:

Sequence, based on SEQRES records:

>d1sp9a2 d.32.1.3 (A:233-428) 4-hydroxyphenylpyruvate dioxygenase, HppD {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
elgpaltyvagftgfhqfaeftaddvgtaesglnsavlasndemvllpinepvhgtkrks
qiqtylehnegaglqhlalmsedifrtlremrkrssiggfdfmpsppptyyqnlkkrvgd
vlsddqikeceelgilvdrddqgtllqiftkplgdrptifieiiqrvgcmmkdeegkayq
sggcggfgkgnfself

Sequence, based on observed residues (ATOM records):

>d1sp9a2 d.32.1.3 (A:233-428) 4-hydroxyphenylpyruvate dioxygenase, HppD {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
elgpaltyvagftgfhqfasglnsavlasndemvllpinepvhgtkrksqiqtylehneg
aglqhlalmsedifrtlremrkrssiggfdfmpsppptyyqnlkkrvgdvlsddqikece
elgilvdrddqgtllqiftkplgdrptifieiiqrvgcmmkdeegkayqsggcggfgkgn
fself

Timeline for d1sp9a2:

• d1sp9a2 first appeared in SCOPe 2.04
  
• d1sp9a2 appears in SCOPe 2.06
  
• d1sp9a2 appears in the current release, SCOPe 2.08