Lineage for d1be3i_ (1be3 I:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2611009Fold d.184: Non-globular alpha+beta subunits of globular proteins [56567] (1 superfamily)
    not a true fold
  4. 2611010Superfamily d.184.1: Non-globular alpha+beta subunits of globular proteins [56568] (4 families) (S)
    not a true superfamily
  5. 2611025Family d.184.1.3: Ubiquinol-cytochrome c reductase 8 kDa protein [90077] (2 proteins)
    beta-hairpin and a short alpha-helix bound to the core subunits
  6. 2611046Protein automated matches [254424] (1 species)
    not a true protein
  7. 2611047Species Cow (Bos taurus) [TaxId:9913] [254879] (3 PDB entries)
  8. 2611049Domain d1be3i_: 1be3 I: [238525]
    Other proteins in same PDB: d1be3a1, d1be3a2, d1be3b1, d1be3b2, d1be3c2, d1be3c3, d1be3d2, d1be3d3, d1be3e1, d1be3e2, d1be3f_, d1be3g_, d1be3h_, d1be3j_, d1be3k_
    automated match to d2a06i_
    complexed with fes, hec, hem

Details for d1be3i_

PDB Entry: 1be3 (more details), 3 Å

PDB Description: cytochrome bc1 complex from bovine
PDB Compounds: (I:) cytochrome bc1 complex

SCOPe Domain Sequences for d1be3i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1be3i_ d.184.1.3 (I:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
krsvlcreslrgqaagrplvasvslnvpasvry

SCOPe Domain Coordinates for d1be3i_:

Click to download the PDB-style file with coordinates for d1be3i_.
(The format of our PDB-style files is described here.)

Timeline for d1be3i_: