Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.184: Non-globular alpha+beta subunits of globular proteins [56567] (1 superfamily) not a true fold |
Superfamily d.184.1: Non-globular alpha+beta subunits of globular proteins [56568] (4 families) not a true superfamily |
Family d.184.1.3: Ubiquinol-cytochrome c reductase 8 kDa protein [90077] (2 proteins) beta-hairpin and a short alpha-helix bound to the core subunits |
Protein automated matches [254424] (1 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [254879] (3 PDB entries) |
Domain d1be3i_: 1be3 I: [238525] Other proteins in same PDB: d1be3a1, d1be3a2, d1be3b1, d1be3b2, d1be3c2, d1be3c3, d1be3d2, d1be3d3, d1be3e1, d1be3e2, d1be3f_, d1be3g_, d1be3h_, d1be3j_, d1be3k_ automated match to d2a06i_ complexed with fes, hec, hem |
PDB Entry: 1be3 (more details), 3 Å
SCOPe Domain Sequences for d1be3i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1be3i_ d.184.1.3 (I:) automated matches {Cow (Bos taurus) [TaxId: 9913]} krsvlcreslrgqaagrplvasvslnvpasvry
Timeline for d1be3i_: