SCOPe 2.03: Domain d3sfia2: 3sfi A:95-214

Lineage for d3sfia2 (3sfi A:95-214)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)

6. Protein automated matches [226970] (3 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [232226] (4 PDB entries)

8. Domain d3sfia2: 3sfi A:95-214 [238508]
   Other proteins in same PDB: d3sfia1
   automated match to d3g1ma2
   protein/DNA complex; complexed with 3sf

Details for d3sfia2

PDB Entry: 3sfi, 2.31 Å

PDB Description: ethionamide boosters part 2: combining bioisosteric replacement and structure-based drug design to solve pharmacokinetic issues in a series of potent 1,2,4-oxadiazole ethr inhibitors.

PDB Compounds: (A:) Transcriptional regulatory repressor protein (TETR-family)

SCOPe Domain Sequences for d3sfia2:

Sequence; same for both SEQRES and ATOM records:

>d3sfia2 a.121.1.1 (A:95-214) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
adtdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavid
aerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge

Timeline for d3sfia2:

• d3sfia2 is new in SCOPe 2.03-stable
  
• d3sfia2 appears in SCOPe 2.04
  
• d3sfia2 appears in the current release, SCOPe 2.08