SCOPe 2.06: Domain d4pz0a_: 4pz0 A:

Lineage for d4pz0a_ (4pz0 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)

6. Protein automated matches [190296] (11 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:198094] [238505] (1 PDB entry)

8. Domain d4pz0a_: 4pz0 A: [238506]
   automated match to d1tm2a_
   complexed with cl, edo, pav

Details for d4pz0a_

PDB Entry: 4pz0, 1.25 Å

PDB Description: the crystal structure of a solute binding protein from bacillus anthracis str. ames in complex with quorum-sensing signal autoinducer-2 (ai-2)

PDB Compounds: (A:) Sugar ABC transporter, sugar-binding protein

SCOPe Domain Sequences for d4pz0a_:

Sequence; same for both SEQRES and ATOM records:

>d4pz0a_ c.93.1.1 (A:) automated matches {Bacillus anthracis [TaxId: 198094]}
dkkkaddvkfafipkltgvgfftsggegakemgdklgvqvkydgpseasvsgqvkyinnf
inqnydalmvsstsvdglsqslqrakkkgmtvltwdsdvnpkdrsfyisqgtpdqlanll
iemtskqigdkgkvaffyssptvtdqnqwvtkakeiikekypnweivttqygennaqksl
svgenilktypdinavicpdatalpamaqaaenlkmdkkvvvtgfstpnvmrdyvkrgtv
qqfglwdvkqqgalatyvaneivvkgkklkvgdsfevkgigkvkvepnsiqgydyeaegn
giivlpervvftkdnidkynf

Timeline for d4pz0a_:

• d4pz0a_ first appeared in SCOPe 2.03
  
• d4pz0a_ appears in SCOPe 2.05
  
• d4pz0a_ appears in SCOPe 2.07
  
• d4pz0a_ appears in the current release, SCOPe 2.08