| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
| Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
| Protein NK cell-activating receptor nkg2d [64453] (2 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [64454] (2 PDB entries) |
| Domain d4pp8b_: 4pp8 B: [238499] Other proteins in same PDB: d4pp8c_, d4pp8d_ complexed with gol |
PDB Entry: 4pp8 (more details), 1.95 Å
SCOPe Domain Sequences for d4pp8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pp8b_ d.169.1.1 (B:) NK cell-activating receptor nkg2d {Mouse (Mus musculus) [TaxId: 10090]}
megycgpcpnnwichrnncyqffneektwnqsqasclsqnssllkiyskeeqdflklvks
yhwmglvqipangswqwedgsslsynqltlveipkgscavygssfkaytedcanlntyic
mkrav
Timeline for d4pp8b_: