SCOPe 2.08: Domain d1kaca_: 1kac A:

Lineage for d1kaca_ (1kac A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
   sandwich, 10 strands in 2 sheets; greek-key

4. Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families)

5. Family b.21.1.1: Adenovirus fiber protein 'knob' domain [49836] (2 proteins)
   automatically mapped to Pfam PF00541

6. Protein Adenovirus fiber protein 'knob' domain [49837] (18 species)

7. Species Human adenovirus type 12 [TaxId:28282] [49840] (4 PDB entries)

8. Domain d1kaca_: 1kac A: [23849]
   Other proteins in same PDB: d1kacb_

Details for d1kaca_

PDB Entry: 1kac, 2.6 Å

PDB Description: knob domain from adenovirus serotype 12 in complex with domain 1 of its cellular receptor car

PDB Compounds: (A:) protein (fiber knob protein)

SCOPe Domain Sequences for d1kaca_:

Sequence; same for both SEQRES and ATOM records:

>d1kaca_ b.21.1.1 (A:) Adenovirus fiber protein 'knob' domain {Human adenovirus type 12 [TaxId: 28282]}
tpydpltlwttpdpppncsliqeldakltlcltkngsivngivslvgvkgnllniqsttt
tvgvhlvfdeqgrlitstptalvpqaswgyrqgqsvstntvtnglgfmpnvsayprpnas
eaksqmvsltylqgdtskpitmkvafngitslngysltfmwsglsnyinqpfstpscsfs
yitqe

Timeline for d1kaca_:

• d1kaca_ first appeared (with stable ids) in SCOP 1.55
  
• d1kaca_ appears in SCOPe 2.07