SCOPe 2.03: Domain d4p8sa_: 4p8s A:

Lineage for d4p8sa_ (4p8s A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.0: automated matches [191489] (1 protein)
   not a true family

6. Protein automated matches [190787] (6 species)
   not a true protein

7. Species Rattus norvegicus [TaxId:10116] [238487] (1 PDB entry)

8. Domain d4p8sa_: 4p8s A: [238488]
   automated match to d1p8ta_
   complexed with ndg

Details for d4p8sa_

PDB Entry: 4p8s, 1.8 Å

PDB Description: crystal structure of nogo-receptor-2

PDB Compounds: (A:) Reticulon-4 receptor-like 2

SCOPe Domain Sequences for d4p8sa_:

Sequence; same for both SEQRES and ATOM records:

>d4p8sa_ c.10.2.0 (A:) automated matches {Rattus norvegicus [TaxId: 10116]}
pscpmlctcysspptvscqannfssvplslppstqrlflqnnlirslrpgtfgpnlltlw
lfsnnlstiypgtfrhlqaleeldlgdnrhlrslepdtfqglerlqslhlyrcqlsslpg
nifrglvslqylylqensllhlqddlfadlanlshlflhgnrlrlltehvfrglgsldrl
llhgnrlqgvhraafhglsrltilylfnnslaslpgealadlpaleflrlnanpwacdcr
arplwawfqrarvsssdvtcatpperqgrdlrtlrdtdfqac

Timeline for d4p8sa_:

• d4p8sa_ is new in SCOPe 2.03-stable
  
• d4p8sa_ appears in SCOPe 2.04
  
• d4p8sa_ appears in the current release, SCOPe 2.08