Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.2: L domain-like [52058] (9 families) less regular structure consisting of variable repeats |
Family c.10.2.0: automated matches [191489] (1 protein) not a true family |
Protein automated matches [190787] (6 species) not a true protein |
Species Rattus norvegicus [TaxId:10116] [238487] (1 PDB entry) |
Domain d4p8sa_: 4p8s A: [238488] automated match to d1p8ta_ complexed with ndg |
PDB Entry: 4p8s (more details), 1.8 Å
SCOPe Domain Sequences for d4p8sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4p8sa_ c.10.2.0 (A:) automated matches {Rattus norvegicus [TaxId: 10116]} pscpmlctcysspptvscqannfssvplslppstqrlflqnnlirslrpgtfgpnlltlw lfsnnlstiypgtfrhlqaleeldlgdnrhlrslepdtfqglerlqslhlyrcqlsslpg nifrglvslqylylqensllhlqddlfadlanlshlflhgnrlrlltehvfrglgsldrl llhgnrlqgvhraafhglsrltilylfnnslaslpgealadlpaleflrlnanpwacdcr arplwawfqrarvsssdvtcatpperqgrdlrtlrdtdfqac
Timeline for d4p8sa_: