Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (18 species) not a true protein |
Species Drosophila melanogaster [TaxId:7227] [238471] (1 PDB entry) |
Domain d4nt4a_: 4nt4 A: [238472] automated match to d1ckia_ complexed with gol, so4 |
PDB Entry: 4nt4 (more details), 2.86 Å
SCOPe Domain Sequences for d4nt4a_:
Sequence, based on SEQRES records: (download)
>d4nt4a_ d.144.1.0 (A:) automated matches {Drosophila melanogaster [TaxId: 7227]} avlmvgpnfrvgkkigcgnfgelrlgknlynnehvaikmepmkskapqlhleyrfykllg shadnapdgipriyhlgtcggrynamvlellglsledlfnicarkfslktvlmiakqllh rieyvhsrhliyrdvkpenfligrtstkrekiihiidfglakeyidldtnrhipyrehks ltgtarymsinthmgreqsrrddlealghmfmyflrgslpwqglkadtlkeryqkigdtk ratpievlcdghpeefatylryvrrldffetpdydflrrlfqdlfdrkgytdegefdwtg kt
>d4nt4a_ d.144.1.0 (A:) automated matches {Drosophila melanogaster [TaxId: 7227]} avlmvgpnfrvgkkigcfgelrlgknlynnehvaikmepmkskapqlhleyrfykllgsh adnapdgipriyhlgtcggrynamvlellglsledlfnicarkfslktvlmiakqllhri eyvhsrhliyrdvkpenfligrtstkrekiihiidfglakeyidldtnrhipyrehkslt gtarymsinthmgreqsrrddlealghmfmyflrgslpwqglkadtlkeryqkigdtkra tpievlcdghpeefatylryvrrldffetpdydflrrlfqdlfdrkgytdegefdwtgkt
Timeline for d4nt4a_: