Lineage for d4mqwh_ (4mqw H:)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1461751Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 1461752Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 1461959Family g.17.1.4: Gonadodropin/Follitropin [57528] (4 proteins)
  6. 1461985Protein automated matches [194842] (1 species)
    not a true protein
  7. 1461986Species Human (Homo sapiens) [TaxId:9606] [194843] (2 PDB entries)
  8. 1461995Domain d4mqwh_: 4mqw H: [238442]
    Other proteins in same PDB: d4mqwa_, d4mqwd_
    automated match to d4ay9h_
    complexed with edo, jef, nag

Details for d4mqwh_

PDB Entry: 4mqw (more details), 2.9 Å

PDB Description: structure of follicle-stimulating hormone in complex with the entire ectodomain of its receptor (p31)
PDB Compounds: (H:) follitropin subunit beta

SCOPe Domain Sequences for d4mqwh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mqwh_ g.17.1.4 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nsceltnitiaiekeecrfcisinttwcagycytrdlvykdparpkiqktctfkelvyet
vrvpgcahhadslytypvatqchcgkcdsdstdctvrglgpsycsfge

SCOPe Domain Coordinates for d4mqwh_:

Click to download the PDB-style file with coordinates for d4mqwh_.
(The format of our PDB-style files is described here.)

Timeline for d4mqwh_: