Lineage for d4mqwh_ (4mqw H:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033576Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 3033577Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 3033866Family g.17.1.4: Gonadodropin/Follitropin [57528] (4 proteins)
  6. 3033867Protein Follicle stimulating hormone, follitropin, beta chain [64562] (1 species)
  7. 3033868Species Human (Homo sapiens) [TaxId:9606] [64563] (3 PDB entries)
  8. 3033871Domain d4mqwh_: 4mqw H: [238442]
    Other proteins in same PDB: d4mqwa_, d4mqwd_, d4mqwg_
    automated match to d4ay9h_
    complexed with edo, jef, nag

Details for d4mqwh_

PDB Entry: 4mqw (more details), 2.9 Å

PDB Description: structure of follicle-stimulating hormone in complex with the entire ectodomain of its receptor (p31)
PDB Compounds: (H:) follitropin subunit beta

SCOPe Domain Sequences for d4mqwh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mqwh_ g.17.1.4 (H:) Follicle stimulating hormone, follitropin, beta chain {Human (Homo sapiens) [TaxId: 9606]}
nsceltnitiaiekeecrfcisinttwcagycytrdlvykdparpkiqktctfkelvyet
vrvpgcahhadslytypvatqchcgkcdsdstdctvrglgpsycsfge

SCOPe Domain Coordinates for d4mqwh_:

Click to download the PDB-style file with coordinates for d4mqwh_.
(The format of our PDB-style files is described here.)

Timeline for d4mqwh_: