Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (12 species) not a true protein |
Species Mus musculus [TaxId:10090] [238130] (4 PDB entries) |
Domain d4lvhl2: 4lvh L:111-210 [238437] Other proteins in same PDB: d4lvhc1, d4lvhf1, d4lvhl1 automated match to d1l7tl2 complexed with ca |
PDB Entry: 4lvh (more details), 2.8 Å
SCOPe Domain Sequences for d4lvhl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lvhl2 b.1.1.2 (L:111-210) automated matches {Mus musculus [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkinvkwkidgserqngvlnswtdqds kdstysmsstltldeyerhnsytceathktstspivksfn
Timeline for d4lvhl2:
View in 3D Domains from other chains: (mouse over for more information) d4lvhc1, d4lvhc2, d4lvhf1, d4lvhf2 |