Lineage for d4k1fa_ (4k1f A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1853530Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 1853871Protein automated matches [190100] (17 species)
    not a true protein
  7. 1854136Species Leishmania major [TaxId:5664] [226407] (3 PDB entries)
  8. 1854138Domain d4k1fa_: 4k1f A: [238391]
    automated match to d1qmva_
    complexed with cl, pe8, peg, pge

Details for d4k1fa_

PDB Entry: 4k1f (more details), 2.34 Å

PDB Description: crystal structure of reduced tryparedoxin peroxidase from leishmania major at 2.34 a resolution
PDB Compounds: (A:) tryparedoxin peroxidase

SCOPe Domain Sequences for d4k1fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k1fa_ c.47.1.10 (A:) automated matches {Leishmania major [TaxId: 5664]}
scgnakinspapsfeevalmpngsfkkislssykgkwvvlffypldftfvcpteviafsd
svsrfnelncevlacsidseyahlqwtlqdrkkgglgtmaipiladktkniarsygvlee
sqgvayrglfiidphgmlrqitvndmpvgrsveevlrlleafqfvekhgevcpanwkkgd
pgmkpepnasvegyfskq

SCOPe Domain Coordinates for d4k1fa_:

Click to download the PDB-style file with coordinates for d4k1fa_.
(The format of our PDB-style files is described here.)

Timeline for d4k1fa_: