SCOPe 2.03: Domain d4k1qa_: 4k1q A:

Lineage for d4k1qa_ (4k1q A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
   automatically mapped to Pfam PF00194

6. Protein Carbonic anhydrase [51071] (10 species)

7. Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (457 PDB entries)
   Uniprot P00918

8. Domain d4k1qa_: 4k1q A: [238382]
   automated match to d1ugda_
   complexed with zn; mutant

Details for d4k1qa_

PDB Entry: 4k1q, 1.7 Å

PDB Description: Structure of hCAIX mimic (hCAII with 5 mutations in active site)

PDB Compounds: (A:) Carbonic anhydrase 2

SCOPe Domain Sequences for d4k1qa_:

Sequence; same for both SEQRES and ATOM records:

>d4k1qa_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]}
hhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnn
ghsfqvtfddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvh
wntkygdlgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktegksadftnfdprg
llpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvd
nwrpaqplknrqikasfk

Timeline for d4k1qa_:

• d4k1qa_ is new in SCOPe 2.03-stable
  
• d4k1qa_ appears in SCOPe 2.04
  
• d4k1qa_ appears in the current release, SCOPe 2.08