Lineage for d4jp5c_ (4jp5 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2887827Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2887828Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2888268Protein Uridine phosphorylase [53176] (6 species)
  7. 2888625Species Yersinia pestis [TaxId:632] [238361] (1 PDB entry)
  8. 2888628Domain d4jp5c_: 4jp5 C: [238369]
    automated match to d4i2vc_
    complexed with edo, gol, so4

Details for d4jp5c_

PDB Entry: 4jp5 (more details), 2.27 Å

PDB Description: X-ray structure of uridine phosphorylase from Yersinia pseudotuberculosis in unliganded state at 2.27 A resolution
PDB Compounds: (C:) Uridine phosphorylase

SCOPe Domain Sequences for d4jp5c_:

Sequence, based on SEQRES records: (download)

>d4jp5c_ c.56.2.1 (C:) Uridine phosphorylase {Yersinia pestis [TaxId: 632]}
ksdvfhlgltkndlqgatlaivpgdpqrvekiaklmdnpvhlashreftswraeldgkav
ivcstgiggpstsiaveelaqlgvrtflrigttgaiqphinvgdvlvttaavrldgaslh
fapmefpavadfscttalvnaaksvgatthigitassdtfypgqerydtfsgrvvrhfkg
smeewqsmgvmnyemesatlltmcasqglragmvagvivnrtqqeipneetmkateshav
kivveaarhll

Sequence, based on observed residues (ATOM records): (download)

>d4jp5c_ c.56.2.1 (C:) Uridine phosphorylase {Yersinia pestis [TaxId: 632]}
ksdvfhlgltkndlqgatlaivpgdpqrvekiaklmdnpvhlashreftswraeldgkav
ivcstgiggpstsiaveelaqlgvrtflrigttgaiqphinvgdvlvttaavrldgaslh
fapmefpavadfscttalvnaaksvgatthigitassdtfypgqerydtfsgrvvrhfkg
smeewqsmgvmnyemesatlltmcasqglragmvagvivnrtqqshavkivveaarhll

SCOPe Domain Coordinates for d4jp5c_:

Click to download the PDB-style file with coordinates for d4jp5c_.
(The format of our PDB-style files is described here.)

Timeline for d4jp5c_: