Lineage for d4h8wc2 (4h8w C:98-176)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295282Family b.1.1.3: C2 set domains [49142] (8 proteins)
  6. 1295292Protein CD4 C2-set domains [49149] (2 species)
  7. 1295293Species Human (Homo sapiens) [TaxId:9606] [49150] (29 PDB entries)
  8. 1295298Domain d4h8wc2: 4h8w C:98-176 [238360]
    Other proteins in same PDB: d4h8wc1, d4h8wl1, d4h8wl2
    automated match to d1g9mc2
    complexed with gol, mrd, nag

Details for d4h8wc2

PDB Entry: 4h8w (more details), 1.85 Å

PDB Description: crystal structure of non-neutralizing and adcc-potent antibody n5-i5 in complex with hiv-1 clade a/e gp120 and scd4.
PDB Compounds: (C:) T-cell surface glycoprotein cd4

SCOPe Domain Sequences for d4h8wc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h8wc2 b.1.1.3 (C:98-176) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidivv

SCOPe Domain Coordinates for d4h8wc2:

Click to download the PDB-style file with coordinates for d4h8wc2.
(The format of our PDB-style files is described here.)

Timeline for d4h8wc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4h8wc1