Lineage for d4cfza_ (4cfz A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1366720Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 1366721Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 1366722Family c.41.1.1: Subtilases [52744] (14 proteins)
  6. 1366790Protein Subtilisin [52745] (6 species)
  7. 1366856Species Bacillus lentus, savinase (TM) [TaxId:1467] [52749] (5 PDB entries)
    Uniprot P29600
  8. 1366861Domain d4cfza_: 4cfz A: [238345]
    automated match to d1svna_
    complexed with ca, na, so4

Details for d4cfza_

PDB Entry: 4cfz (more details), 1.57 Å

PDB Description: savinase crystal structures for combined single crystal diffraction and powder diffraction analysis
PDB Compounds: (A:) Subtilisin Savinase

SCOPe Domain Sequences for d4cfza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cfza_ c.41.1.1 (A:) Subtilisin {Bacillus lentus, savinase (TM) [TaxId: 1467]}
aqsvpwgisrvqapaahnrgltgsgvkvavldtgisthpdlnirggasfvpgepstqdgn
ghgthvagtiaalnnsigvlgvapsaelyavkvlgasgsgsvssiaqglewagnngmhva
nlslgspspsatleqavnsatsrgvlvvaasgnsgagsisyparyanamavgatdqnnnr
asfsqygagldivapgvnvqstypgstyaslngtsmatphvagaaalvkqknpswsnvqi
rnhlkntatslgstnlygsglvnaeaatr

SCOPe Domain Coordinates for d4cfza_:

Click to download the PDB-style file with coordinates for d4cfza_.
(The format of our PDB-style files is described here.)

Timeline for d4cfza_: