Lineage for d4pw0a_ (4pw0 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2902087Species Chitinophaga pinensis [TaxId:485918] [238323] (1 PDB entry)
  8. 2902088Domain d4pw0a_: 4pw0 A: [238324]
    automated match to d4lxga_
    complexed with cl

Details for d4pw0a_

PDB Entry: 4pw0 (more details), 1.48 Å

PDB Description: alpha/beta hydrolase fold protein from chitinophaga pinensis
PDB Compounds: (A:) Alpha/beta hydrolase fold protein

SCOPe Domain Sequences for d4pw0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pw0a_ c.69.1.0 (A:) automated matches {Chitinophaga pinensis [TaxId: 485918]}
ndhataptqyievngtryayrslgapsdiplicfqhftgtldnwdplitnglskgrqlii
fdnkgvglssgttpdnvaamtadalefitalgiryfdvlgfslggfivqymahiqpdmir
kiiivgaapqgvkvlhtfpdliaramqlepkerflfiffeqsehsrskglatlgrlyert
tdrdqdasaqaigaqltaitnwgkktpsfeitsiqhpvfvvqgsndemmdtynsyelfkq
lpdailslypdaahgsfyqypelfvsqteyfldsy

SCOPe Domain Coordinates for d4pw0a_:

Click to download the PDB-style file with coordinates for d4pw0a_.
(The format of our PDB-style files is described here.)

Timeline for d4pw0a_: