![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily) duplication: composed of two very similar alpha+beta folds |
![]() | Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) ![]() |
![]() | Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins) |
![]() | Protein automated matches [195197] (6 species) not a true protein |
![]() | Species Yersinia pestis [TaxId:632] [238319] (1 PDB entry) |
![]() | Domain d4pv4a2: 4pv4 A:175-436 [238322] Other proteins in same PDB: d4pv4a1, d4pv4b1 automated match to d1n51a2 complexed with 1pe, edo, mg, p6g, pge |
PDB Entry: 4pv4 (more details), 1.76 Å
SCOPe Domain Sequences for d4pv4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pv4a2 d.127.1.1 (A:175-436) automated matches {Yersinia pestis [TaxId: 632]} saeeiavlrrageisalahtramekcrpgmfeyqlegeilheftrhgarypayntivggg engcilhytenecelrdgdlvlidagceyrgyagditrtfpvngkftpaqravydivlaa inksltlfrpgtsirevteevvrimvvglvelgilkgdieqliaeqahrpffmhglshwl gmdvhdvgdygssdrgrilepgmvltvepglyiapdadvppqyrgigirieddivitatg nenltasvvkdpddiealmaln
Timeline for d4pv4a2: