Lineage for d4pv4a2 (4pv4 A:175-436)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2974562Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 2974563Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) (S)
  5. 2974564Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)
  6. 2974703Protein automated matches [195197] (6 species)
    not a true protein
  7. 2974734Species Yersinia pestis [TaxId:632] [238319] (1 PDB entry)
  8. 2974735Domain d4pv4a2: 4pv4 A:175-436 [238322]
    Other proteins in same PDB: d4pv4a1, d4pv4b1
    automated match to d1n51a2
    complexed with 1pe, edo, mg, p6g, pge

Details for d4pv4a2

PDB Entry: 4pv4 (more details), 1.76 Å

PDB Description: proline aminopeptidase p ii from yersinia pestis
PDB Compounds: (A:) Proline aminopeptidase P II

SCOPe Domain Sequences for d4pv4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pv4a2 d.127.1.1 (A:175-436) automated matches {Yersinia pestis [TaxId: 632]}
saeeiavlrrageisalahtramekcrpgmfeyqlegeilheftrhgarypayntivggg
engcilhytenecelrdgdlvlidagceyrgyagditrtfpvngkftpaqravydivlaa
inksltlfrpgtsirevteevvrimvvglvelgilkgdieqliaeqahrpffmhglshwl
gmdvhdvgdygssdrgrilepgmvltvepglyiapdadvppqyrgigirieddivitatg
nenltasvvkdpddiealmaln

SCOPe Domain Coordinates for d4pv4a2:

Click to download the PDB-style file with coordinates for d4pv4a2.
(The format of our PDB-style files is described here.)

Timeline for d4pv4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4pv4a1