Lineage for d4pv4a1 (4pv4 A:1-174)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885765Superfamily c.55.2: Creatinase/prolidase N-terminal domain [53092] (2 families) (S)
  5. 2885824Family c.55.2.0: automated matches [238315] (1 protein)
    not a true family
  6. 2885825Protein automated matches [238316] (2 species)
    not a true protein
  7. 2885830Species Yersinia pestis [TaxId:632] [238317] (1 PDB entry)
  8. 2885831Domain d4pv4a1: 4pv4 A:1-174 [238321]
    Other proteins in same PDB: d4pv4a2, d4pv4b2
    automated match to d2v3za1
    complexed with 1pe, edo, mg, p6g, pge

Details for d4pv4a1

PDB Entry: 4pv4 (more details), 1.76 Å

PDB Description: proline aminopeptidase p ii from yersinia pestis
PDB Compounds: (A:) Proline aminopeptidase P II

SCOPe Domain Sequences for d4pv4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pv4a1 c.55.2.0 (A:1-174) automated matches {Yersinia pestis [TaxId: 632]}
mtqqeyqnrrqallakmapgsaaiifaapeatrsadseypyrqnsdfsyltgfnepeavl
ilvksdethnhsvlfnrirdltaeiwfgrrlgqeaaptklavdralpfdeineqlyllln
rldviyhaqgqyayadnivfaaleklrhgfrknlrapatltdwrpwlhemrlfk

SCOPe Domain Coordinates for d4pv4a1:

Click to download the PDB-style file with coordinates for d4pv4a1.
(The format of our PDB-style files is described here.)

Timeline for d4pv4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4pv4a2