SCOPe 2.08: Domain d4pv4a1: 4pv4 A:1-174

Lineage for d4pv4a1 (4pv4 A:1-174)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.2: Creatinase/prolidase N-terminal domain [53092] (2 families)

5. Family c.55.2.0: automated matches [238315] (1 protein)
   not a true family

6. Protein automated matches [238316] (2 species)
   not a true protein

7. Species Yersinia pestis [TaxId:632] [238317] (1 PDB entry)

8. Domain d4pv4a1: 4pv4 A:1-174 [238321]
   Other proteins in same PDB: d4pv4a2, d4pv4b2
   automated match to d2v3za1
   complexed with 1pe, edo, mg, p6g, pge

Details for d4pv4a1

PDB Entry: 4pv4, 1.76 Å

PDB Description: proline aminopeptidase p ii from yersinia pestis

PDB Compounds: (A:) Proline aminopeptidase P II

SCOPe Domain Sequences for d4pv4a1:

Sequence; same for both SEQRES and ATOM records:

>d4pv4a1 c.55.2.0 (A:1-174) automated matches {Yersinia pestis [TaxId: 632]}
mtqqeyqnrrqallakmapgsaaiifaapeatrsadseypyrqnsdfsyltgfnepeavl
ilvksdethnhsvlfnrirdltaeiwfgrrlgqeaaptklavdralpfdeineqlyllln
rldviyhaqgqyayadnivfaaleklrhgfrknlrapatltdwrpwlhemrlfk

Timeline for d4pv4a1:

• d4pv4a1 first appeared in SCOPe 2.03
  
• d4pv4a1 appears in SCOPe 2.07