Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.2: Creatinase/prolidase N-terminal domain [53092] (2 families) |
Family c.55.2.0: automated matches [238315] (1 protein) not a true family |
Protein automated matches [238316] (2 species) not a true protein |
Species Yersinia pestis [TaxId:632] [238317] (1 PDB entry) |
Domain d4pv4b1: 4pv4 B:1-174 [238318] Other proteins in same PDB: d4pv4a2, d4pv4b2 automated match to d2v3za1 complexed with 1pe, edo, mg, p6g, pge |
PDB Entry: 4pv4 (more details), 1.76 Å
SCOPe Domain Sequences for d4pv4b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pv4b1 c.55.2.0 (B:1-174) automated matches {Yersinia pestis [TaxId: 632]} mtqqeyqnrrqallakmapgsaaiifaapeatrsadseypyrqnsdfsyltgfnepeavl ilvksdethnhsvlfnrirdltaeiwfgrrlgqeaaptklavdralpfdeineqlyllln rldviyhaqgqyayadnivfaaleklrhgfrknlrapatltdwrpwlhemrlfk
Timeline for d4pv4b1: