SCOPe 2.03: Domain d4p54a_: 4p54 A:

Lineage for d4p54a_ (4p54 A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.0: automated matches [191488] (1 protein)
   not a true family

6. Protein automated matches [190781] (23 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:85963] [189517] (5 PDB entries)

8. Domain d4p54a_: 4p54 A: [238310]
   automated match to d4bmza_
   complexed with cl, mta; mutant

Details for d4p54a_

PDB Entry: 4p54, 1.65 Å

PDB Description: Crystal Structure of the Helicobacter pylori MTAN-D198N mutant with 5'-methylthioadenosine in the active site.

PDB Compounds: (A:) Aminodeoxyfutalosine nucleosidase

SCOPe Domain Sequences for d4p54a_:

Sequence; same for both SEQRES and ATOM records:

>d4p54a_ c.56.2.0 (A:) automated matches {Helicobacter pylori [TaxId: 85963]}
mgqkigilgamreeitpilelfgvdfeeiplggnvfhkgvyhnkeiivayskigkvhstl
tttsmilafgvqkvlfsgvagslvkdlkindllvatqlvqhdvdlsafdhplgfipesai
fietsgslnalakkianeqhialkegviasgdqfvhskerkeflvsefkasavemegasv
afvcqkfgvpccvlrsisnnadekagmsfdefleksahtsakflksmvdel

Timeline for d4p54a_:

• d4p54a_ is new in SCOPe 2.03-stable
  
• d4p54a_ appears in SCOPe 2.04
  
• d4p54a_ appears in the current release, SCOPe 2.08