SCOPe 2.06: Domain d4ow6a3: 4ow6 A:381-535

Lineage for d4ow6a3 (4ow6 A:381-535)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.1: Diphtheria toxin, C-terminal domain [49380] (2 families)
   automatically mapped to Pfam PF01324

5. Family b.2.1.1: Diphtheria toxin, C-terminal domain [49381] (1 protein)

6. Protein Diphtheria toxin, C-terminal domain [49382] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [49383] (7 PDB entries)

8. Domain d4ow6a3: 4ow6 A:381-535 [238301]
   Other proteins in same PDB: d4ow6a1, d4ow6a2, d4ow6b1, d4ow6b2
   automated match to d1ddta1

Details for d4ow6a3

PDB Entry: 4ow6, 2.8 Å

PDB Description: Crystal structure of Diphtheria Toxin at acidic pH

PDB Compounds: (A:) diphtheria toxin

SCOPe Domain Sequences for d4ow6a3:

Sequence; same for both SEQRES and ATOM records:

>d4ow6a3 b.2.1.1 (A:381-535) Diphtheria toxin, C-terminal domain {Corynebacterium diphtheriae [TaxId: 1717]}
spghktqpflhdgyavswntvedsiirtgfqgesghdikitaentplpiagvllptipgk
ldvnkskthisvngrkirmrcraidgdvtfcrpkspvyvgngvhanlhvafhrsssekih
sneissdsigvlgyqktvdhtkvnsklslffeiks

Timeline for d4ow6a3:

• d4ow6a3 first appeared in SCOPe 2.03
  
• d4ow6a3 appears in SCOPe 2.05
  
• d4ow6a3 appears in SCOPe 2.07
  
• d4ow6a3 appears in the current release, SCOPe 2.08