Class b: All beta proteins [48724] (174 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.1: Diphtheria toxin, C-terminal domain [49380] (1 family) automatically mapped to Pfam PF01324 |
Family b.2.1.1: Diphtheria toxin, C-terminal domain [49381] (1 protein) |
Protein Diphtheria toxin, C-terminal domain [49382] (1 species) |
Species Corynebacterium diphtheriae [TaxId:1717] [49383] (7 PDB entries) |
Domain d4ow6b3: 4ow6 B:381-535 [238298] Other proteins in same PDB: d4ow6a1, d4ow6a2, d4ow6b1, d4ow6b2 automated match to d1ddta1 |
PDB Entry: 4ow6 (more details), 2.8 Å
SCOPe Domain Sequences for d4ow6b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ow6b3 b.2.1.1 (B:381-535) Diphtheria toxin, C-terminal domain {Corynebacterium diphtheriae [TaxId: 1717]} spghktqpflhdgyavswntvedsiirtgfqgesghdikitaentplpiagvllptipgk ldvnkskthisvngrkirmrcraidgdvtfcrpkspvyvgngvhanlhvafhrsssekih sneissdsigvlgyqktvdhtkvnsklslffeiks
Timeline for d4ow6b3: