Lineage for d4ow6b2 (4ow6 B:200-380)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2250850Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 2250866Superfamily f.1.2: Diphtheria toxin, middle domain [56845] (2 families) (S)
    automatically mapped to Pfam PF02764
  5. 2250867Family f.1.2.1: Diphtheria toxin, middle domain [56846] (1 protein)
  6. 2250868Protein Diphtheria toxin, middle domain [56847] (1 species)
    contains globin-like fold with two additional helices at N-termini but has no counterpart to the first globin helix (A)
  7. 2250869Species Corynebacterium diphtheriae [TaxId:1717] [56848] (7 PDB entries)
  8. 2250880Domain d4ow6b2: 4ow6 B:200-380 [238297]
    Other proteins in same PDB: d4ow6a1, d4ow6a3, d4ow6b1, d4ow6b3
    automated match to d1ddta3

Details for d4ow6b2

PDB Entry: 4ow6 (more details), 2.8 Å

PDB Description: Crystal structure of Diphtheria Toxin at acidic pH
PDB Compounds: (B:) diphtheria toxin

SCOPe Domain Sequences for d4ow6b2:

Sequence, based on SEQRES records: (download)

>d4ow6b2 f.1.2.1 (B:200-380) Diphtheria toxin, middle domain {Corynebacterium diphtheriae [TaxId: 1717]}
scinldwdvirdktktkieslkehgpiknkmsespnktvseekakqyleefhqtalehpe
lselktvtgtnpvfaganyaawavnvaqvidsetadnlekttaalsilpgigsvmgiadg
avhhnteeivaqsialsslmvaqaiplvgelvdigfaaynfvesiinlfqvvhnsynrpa
y

Sequence, based on observed residues (ATOM records): (download)

>d4ow6b2 f.1.2.1 (B:200-380) Diphtheria toxin, middle domain {Corynebacterium diphtheriae [TaxId: 1717]}
scinldwdvirdktktkieslehpelselktvtgtnpvfaganyaawavnvaqvidseta
dnlekttaalsilpgigsvmgiadgavhhnteeivaqsialsslmvaqaiplvgelvdig
faaynfvesiinlfqvvhnsynrpay

SCOPe Domain Coordinates for d4ow6b2:

Click to download the PDB-style file with coordinates for d4ow6b2.
(The format of our PDB-style files is described here.)

Timeline for d4ow6b2: