SCOPe 2.05: Domain d4ow6b2: 4ow6 B:200-380

Lineage for d4ow6b2 (4ow6 B:200-380)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.2: Diphtheria toxin, middle domain [56845] (2 families)
   automatically mapped to Pfam PF02764

5. Family f.1.2.1: Diphtheria toxin, middle domain [56846] (1 protein)

6. Protein Diphtheria toxin, middle domain [56847] (1 species)
   contains globin-like fold with two additional helices at N-termini but has no counterpart to the first globin helix (A)

7. Species Corynebacterium diphtheriae [TaxId:1717] [56848] (7 PDB entries)

8. Domain d4ow6b2: 4ow6 B:200-380 [238297]
   Other proteins in same PDB: d4ow6a1, d4ow6a3, d4ow6b1, d4ow6b3
   automated match to d1ddta3

Details for d4ow6b2

PDB Entry: 4ow6, 2.8 Å

PDB Description: Crystal structure of Diphtheria Toxin at acidic pH

PDB Compounds: (B:) diphtheria toxin

SCOPe Domain Sequences for d4ow6b2:

Sequence, based on SEQRES records:

>d4ow6b2 f.1.2.1 (B:200-380) Diphtheria toxin, middle domain {Corynebacterium diphtheriae [TaxId: 1717]}
scinldwdvirdktktkieslkehgpiknkmsespnktvseekakqyleefhqtalehpe
lselktvtgtnpvfaganyaawavnvaqvidsetadnlekttaalsilpgigsvmgiadg
avhhnteeivaqsialsslmvaqaiplvgelvdigfaaynfvesiinlfqvvhnsynrpa
y

Sequence, based on observed residues (ATOM records):

>d4ow6b2 f.1.2.1 (B:200-380) Diphtheria toxin, middle domain {Corynebacterium diphtheriae [TaxId: 1717]}
scinldwdvirdktktkieslehpelselktvtgtnpvfaganyaawavnvaqvidseta
dnlekttaalsilpgigsvmgiadgavhhnteeivaqsialsslmvaqaiplvgelvdig
faaynfvesiinlfqvvhnsynrpay

Timeline for d4ow6b2:

• d4ow6b2 first appeared in SCOPe 2.03
  
• d4ow6b2 appears in SCOPe 2.04
  
• d4ow6b2 appears in SCOPe 2.06
  
• d4ow6b2 appears in the current release, SCOPe 2.08