Lineage for d4njtb_ (4njt B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1320913Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1320914Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1320915Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 1320931Protein Human immunodeficiency virus type 1 protease [50632] (8 species)
  7. Species Human immunodeficiency virus 1 [TaxId:11676] [224867] (39 PDB entries)
  8. 1321056Domain d4njtb_: 4njt B: [238263]
    automated match to d3mima_
    complexed with 017

Details for d4njtb_

PDB Entry: 4njt (more details), 1.95 Å

PDB Description: Crystal structure of multidrug-resistant clinical isolate A02 HIV-1 protease in complex with darunavir
PDB Compounds: (B:) Protease

SCOPe Domain Sequences for d4njtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4njtb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwqrpivtikvggqlkealldtgaddtvledmelpgrwkprmiggiggfvkvrqyd
qipieicghkvigtvlvgptptniigrnlmtqlgftlnf

SCOPe Domain Coordinates for d4njtb_:

Click to download the PDB-style file with coordinates for d4njtb_.
(The format of our PDB-style files is described here.)

Timeline for d4njtb_: