Lineage for d1eo8a_ (1eo8 A:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 294066Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 294067Superfamily b.19.1: Viral protein domain [49818] (3 families) (S)
    forms homotrimers
  5. 294097Family b.19.1.2: Influenza hemagglutinin headpice [49823] (1 protein)
  6. 294098Protein Hemagglutinin [49824] (1 species)
    includes rudiment esterase domain
  7. 294099Species Influenza A virus, different strains [TaxId:11320] [49825] (25 PDB entries)
  8. 294107Domain d1eo8a_: 1eo8 A: [23823]
    Other proteins in same PDB: d1eo8b_, d1eo8h1, d1eo8h2, d1eo8l1, d1eo8l2
    complexed with man, nag

Details for d1eo8a_

PDB Entry: 1eo8 (more details), 2.8 Å

PDB Description: influenza virus hemagglutinin complexed with a neutralizing antibody

SCOP Domain Sequences for d1eo8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eo8a_ b.19.1.2 (A:) Hemagglutinin {Influenza A virus, different strains}
statlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlid
allgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwt
gvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgihhpstn
qeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsn
gnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpky
vkqntlklatgmrnvpekq

SCOP Domain Coordinates for d1eo8a_:

Click to download the PDB-style file with coordinates for d1eo8a_.
(The format of our PDB-style files is described here.)

Timeline for d1eo8a_: