SCOPe 2.03: Domain d4mlqa2: 4mlq A:219-308

Lineage for d4mlqa2 (4mlq A:219-308)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.50: dsRBD-like [54767] (5 superfamilies)
   alpha-beta(3)-alpha; 2 layers: alpha/beta

4. Superfamily d.50.2: Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain [54782] (2 families)
   automatically mapped to Pfam PF03900

5. Family d.50.2.0: automated matches [227289] (1 protein)
   not a true family

6. Protein automated matches [227108] (2 species)
   not a true protein

7. Species Bacillus megaterium [TaxId:1404] [238215] (1 PDB entry)

8. Domain d4mlqa2: 4mlq A:219-308 [238216]
   Other proteins in same PDB: d4mlqa1
   automated match to d1gtka2
   complexed with 29p, acy, dpm

Details for d4mlqa2

PDB Entry: 4mlq, 1.6 Å

PDB Description: Crystal structure of Bacillus megaterium porphobilinogen deaminase

PDB Compounds: (A:) porphobilinogen deaminase

SCOPe Domain Sequences for d4mlqa2:

Sequence; same for both SEQRES and ATOM records:

>d4mlqa2 d.50.2.0 (A:219-308) automated matches {Bacillus megaterium [TaxId: 1404]}
nhdetaravraervflkemeggcqvpiagygrildggnieltslvaspdgktiykehitg
kdpiaigseaaerltsqgakllidrvkeel

Timeline for d4mlqa2:

• d4mlqa2 is new in SCOPe 2.03-stable
  
• d4mlqa2 appears in SCOPe 2.04
  
• d4mlqa2 appears in the current release, SCOPe 2.08