Class b: All beta proteins [48724] (180 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein Hemagglutinin [49824] (22 species) includes rudiment esterase domain |
Species Influenza A virus, different strains [TaxId:11320] [49825] (131 PDB entries) |
Domain d1hgde_: 1hgd E: [23821] Other proteins in same PDB: d1hgdb_, d1hgdd_, d1hgdf_ complexed with nag |
PDB Entry: 1hgd (more details), 2.7 Å
SCOPe Domain Sequences for d1hgde_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hgde_ b.19.1.2 (E:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]} qdlpgndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrild gidctlidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlef itegftwtgvtqngrsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiw gihhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpg dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki tygacpkyvkqntlklatgmrnvpekqt
Timeline for d1hgde_: