SCOPe 2.08: Domain d4mafh1: 4maf H:49-218

Lineage for d4mafh1 (4maf H:49-218)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (15 families)

5. Family b.122.1.0: automated matches [191599] (1 protein)
   not a true family

6. Protein automated matches [191089] (10 species)
   not a true protein

7. Species Soybean (Glycine max) [TaxId:3847] [237646] (1 PDB entry)

8. Domain d4mafh1: 4maf H:49-218 [238203]
   Other proteins in same PDB: d4mafa2, d4mafb2, d4mafb3, d4mafc2, d4mafc3, d4mafd2, d4mafe2, d4mafe3, d4maff2, d4mafg2, d4mafg3, d4mafh2
   automated match to d4mafa1
   complexed with adx

Details for d4mafh1

PDB Entry: 4maf, 2.48 Å

PDB Description: Soybean ATP Sulfurylase

PDB Compounds: (H:) ATP sulfurylase

SCOPe Domain Sequences for d4mafh1:

Sequence; same for both SEQRES and ATOM records:

>d4mafh1 b.122.1.0 (H:49-218) automated matches {Soybean (Glycine max) [TaxId: 3847]}
liepdggklvelvvtdferdlkkgealslpriklsridlewvhvlsegwatplkgfmrea
eflqtlhfnslrlddgsvvnmsvpivlaiddaqkhrigdnkkvalfdskgdpvailnnie
iykhpkeeriartwgtiapglpyveqtitnagnwliggdleviepiqynd

Timeline for d4mafh1:

• d4mafh1 first appeared in SCOPe 2.03
  
• d4mafh1 appears in SCOPe 2.07