Class b: All beta proteins [48724] (176 folds) |
Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
Superfamily b.122.1: PUA domain-like [88697] (14 families) |
Family b.122.1.0: automated matches [191599] (1 protein) not a true family |
Protein automated matches [191089] (6 species) not a true protein |
Species Soybean (Glycine max) [TaxId:3847] [237646] (1 PDB entry) |
Domain d4mafg1: 4maf G:48-218 [238199] Other proteins in same PDB: d4mafa2, d4mafb2, d4mafc2, d4mafd2, d4mafe2, d4maff2, d4mafg2, d4mafh2 automated match to d4mafc1 complexed with adx |
PDB Entry: 4maf (more details), 2.48 Å
SCOPe Domain Sequences for d4mafg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mafg1 b.122.1.0 (G:48-218) automated matches {Soybean (Glycine max) [TaxId: 3847]} mliepdggklvelvvtdferdlkkgealslpriklsridlewvhvlsegwatplkgfmre aeflqtlhfnslrlddgsvvnmsvpivlaiddaqkhrigdnkkvalfdskgdpvailnni eiykhpkeeriartwgtiapglpyveqtitnagnwliggdleviepiqynd
Timeline for d4mafg1: