Lineage for d4mafe2 (4maf E:219-450)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1359291Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1359292Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1359851Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 1359852Protein automated matches [190459] (31 species)
    not a true protein
  7. 1359926Species Glycine max [TaxId:3847] [237649] (1 PDB entry)
  8. 1359931Domain d4mafe2: 4maf E:219-450 [238198]
    Other proteins in same PDB: d4mafb1, d4mafd1, d4mafe1, d4maff1, d4mafg1, d4mafh1
    automated match to d4mafc2
    complexed with adx

Details for d4mafe2

PDB Entry: 4maf (more details), 2.48 Å

PDB Description: Soybean ATP Sulfurylase
PDB Compounds: (E:) ATP sulfurylase

SCOPe Domain Sequences for d4mafe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mafe2 c.26.1.0 (E:219-450) automated matches {Glycine max [TaxId: 3847]}
gldhfrlsptqlraeftrrnadavfafqlrnpvhnghallmtdtrkrllemgyknpvlll
hplggytkaddvpldwrmkqhekvledgvldpettvvsifpspmhyagptevqwhakari
naganfyivgrdpagmshpvekrdlydadhgkkvlsmapglerlnilpfrvaaydktqgk
maffdpsrpqdflfisgtkmrtlarnkesppdgfmcpggwkvlvdyydslvl

SCOPe Domain Coordinates for d4mafe2:

Click to download the PDB-style file with coordinates for d4mafe2.
(The format of our PDB-style files is described here.)

Timeline for d4mafe2: