Lineage for d4mafd1 (4maf D:48-218)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1564510Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 1564511Superfamily b.122.1: PUA domain-like [88697] (14 families) (S)
  5. 1564760Family b.122.1.0: automated matches [191599] (1 protein)
    not a true family
  6. 1564761Protein automated matches [191089] (6 species)
    not a true protein
  7. 1564779Species Soybean (Glycine max) [TaxId:3847] [237646] (1 PDB entry)
  8. 1564783Domain d4mafd1: 4maf D:48-218 [238195]
    Other proteins in same PDB: d4mafa2, d4mafb2, d4mafc2, d4mafd2, d4mafe2, d4maff2, d4mafg2, d4mafh2
    automated match to d4mafa1
    complexed with adx

Details for d4mafd1

PDB Entry: 4maf (more details), 2.48 Å

PDB Description: Soybean ATP Sulfurylase
PDB Compounds: (D:) ATP sulfurylase

SCOPe Domain Sequences for d4mafd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mafd1 b.122.1.0 (D:48-218) automated matches {Soybean (Glycine max) [TaxId: 3847]}
mliepdggklvelvvtdferdlkkgealslpriklsridlewvhvlsegwatplkgfmre
aeflqtlhfnslrlddgsvvnmsvpivlaiddaqkhrigdnkkvalfdskgdpvailnni
eiykhpkeeriartwgtiapglpyveqtitnagnwliggdleviepiqynd

SCOPe Domain Coordinates for d4mafd1:

Click to download the PDB-style file with coordinates for d4mafd1.
(The format of our PDB-style files is described here.)

Timeline for d4mafd1: