Lineage for d4m0ya_ (4m0y A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2983087Protein Tyrosine-protein kinase Itk/Tsk [111194] (1 species)
    PTK group; Tec/Atk subfamily; non-membrane spanning protein tyrosine kinase
  7. 2983088Species Human (Homo sapiens) [TaxId:9606] [111195] (33 PDB entries)
    Uniprot Q08881 357-619
  8. 2983099Domain d4m0ya_: 4m0y A: [238191]
    automated match to d4hcua_
    complexed with m0y

Details for d4m0ya_

PDB Entry: 4m0y (more details), 1.7 Å

PDB Description: Crystal structure of ITK in complex with compound 1 [4-(carbamoylamino)-1-(naphthalen-1-yl)-1H-pyrazole-3-carboxamide]
PDB Compounds: (A:) Tyrosine-protein kinase ITK/TSK

SCOPe Domain Sequences for d4m0ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m0ya_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}
wvidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmklsh
pklvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmaylee
acvihrdlaarnclvgenqvikvsdfgmtrfvlddqytsstgtkfpvkwaspevfsfsry
ssksdvwsfgvlmwevfsegkipyenrsnsevvedistgfrlykprlasthvyqimnhcw
rerpedrpafsrllrqlaeiaes

SCOPe Domain Coordinates for d4m0ya_:

Click to download the PDB-style file with coordinates for d4m0ya_.
(The format of our PDB-style files is described here.)

Timeline for d4m0ya_: