SCOP 1.63: Domain d1hgda_: 1hgd A:

Lineage for d1hgda_ (1hgd A:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (3 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpice [49823] (1 protein)

6. Protein Hemagglutinin [49824] (1 species)
   includes rudiment esterase domain

7. Species Influenza A virus, different strains [TaxId:11320] [49825] (25 PDB entries)

8. Domain d1hgda_: 1hgd A: [23819]
   Other proteins in same PDB: d1hgdb_, d1hgdd_, d1hgdf_

Details for d1hgda_

PDB Entry: 1hgd, 2.7 Å

PDB Description: binding of influenza virus hemagglutinin to analogs of its cell- surface receptor, sialic acid: analysis by proton nuclear magnetic resonance spectroscopy and x-ray crystallography

SCOP Domain Sequences for d1hgda_:

Sequence; same for both SEQRES and ATOM records:

>d1hgda_ b.19.1.2 (A:) Hemagglutinin {Influenza A virus, different strains}
qdlpgndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrild
gidctlidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlef
itegftwtgvtqngrsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiw
gihhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpg
dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki
tygacpkyvkqntlklatgmrnvpekqt

Timeline for d1hgda_:

• d1hgda_ first appeared (with stable ids) in SCOP 1.55
  
• d1hgda_ appears in SCOP 1.61
  
• d1hgda_ appears in SCOP 1.65
  
• d1hgda_ appears in the current release, SCOPe 2.08