Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Tyrosine-protein kinase Itk/Tsk [111194] (1 species) PTK group; Tec/Atk subfamily; non-membrane spanning protein tyrosine kinase |
Species Human (Homo sapiens) [TaxId:9606] [111195] (26 PDB entries) Uniprot Q08881 357-619 |
Domain d4m12a_: 4m12 A: [238189] automated match to d4hcta_ complexed with 1yz |
PDB Entry: 4m12 (more details), 2.15 Å
SCOPe Domain Sequences for d4m12a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m12a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} kwvidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmkls hpklvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayle eacvihrdlaarnclvgenqvikvsdfgmtrfvlddqytsstgtkfpvkwaspevfsfsr yssksdvwsfgvlmwevfsegkipyenrsnsevvedistgfrlykprlasthvyqimnhc wrerpedrpafsrllrqlaeiaes
Timeline for d4m12a_: